HPVomics

A therapeutic and epitome resource for Human Papillomaviruses

Graphical Representation of Peptide Physiochemical Properties



Peptide Sequence: DSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL

Charge
DSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRL
P+veN-veNOC No charge
Polarity
DSSEEEDEIDGPAGQAE