CoronaVR
PDB Structure details:
| Structure title | Crystal Structure of the HCoV SARS HR1 motif in complex with pan-CoVs inhibitor EK1 |
| Source | SARS-related coronavirus |
| Macromolecule name | Spike glycoprotein |
| Experimental method | X-RAY DIFFRACTION |
| Strucutre Molecular Weight | 40866.67 |
| Residue Count | 372 |
| Sequence | SGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE |
| Chain length | 80 |
| Chain Molecular Weight | 8698.67 |
| Biological process | GO:0046813, GO:0061025 |
| Cellular Component | GO:0016021, GO:0019031 |
| Molecular Function | - |
| Dep. Date | 5/11/2018 |
| Rel. Date | 2019-04-17 201 |
| Rev. Date | 2019-04-17 201 |
| Expression Host | Escherichia coli |