CoronaVR
PDB Structure details:
| Structure title | NMR Structure and Localization of a Large Fragment of the SARS-CoV Fusion Protein: Implications in Viral Cell Fusion |
| Source | SARS-related coronavirus |
| Macromolecule name | Spike protein S2 |
| Experimental method | SOLUTION NMR |
| Strucutre Molecular Weight | 7544.74 |
| Residue Count | 65 |
| Sequence | PRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPSPLKPTKRSFIEDLLFNKVTLADAGFMKQYGE |
| Chain length | 65 |
| Chain Molecular Weight | 7544.74 |
| Biological process | GO:0046813, GO:0061025 |
| Cellular Component | GO:0016021, GO:0019031 |
| Molecular Function | - |
| Dep. Date | 5/2/2017 |
| Rel. Date | 2017-12-06 201 |
| Rev. Date | 2017-12-06 201 |
| Expression Host | Escherichia coli |