CoronaVR
PDB Structure details:
| Structure title | NMR structure of the SARS Coronavirus E protein pentameric ion channel |
| Source | SARS-related coronavirus |
| Macromolecule name | Envelope small membrane protein |
| Experimental method | SOLUTION NMR |
| Strucutre Molecular Weight | 45017.7 |
| Residue Count | 405 |
| Sequence | MHHHHHHSSGVDLGTENLYFQSMETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL |
| Chain length | 81 |
| Chain Molecular Weight | 9003.54 |
| Biological process | - |
| Cellular Component | - |
| Molecular Function | - |
| Dep. Date | 1/31/2017 |
| Rel. Date | 7/4/2018 |
| Rev. Date | 7/4/2018 |
| Expression Host | Escherichia coli BL21(DE3) |