CoronaVR
PDB Structure details:
| Structure title | Crystal structure of SARS-CoV papain-like protease in complex with the C-terminal domain of human ISG15 |
| Source | Homo sapiens |
| Macromolecule name | Ubiquitin-like protein ISG15 |
| Experimental method | X-RAY DIFFRACTION |
| Strucutre Molecular Weight | 89664.65 |
| Residue Count | 796 |
| Sequence | MEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGX |
| Chain length | 79 |
| Chain Molecular Weight | 8909.26 |
| Biological process | - |
| Cellular Component | - |
| Molecular Function | - |
| Dep. Date | 10/10/2016 |
| Rel. Date | 2017-06-14 201 |
| Rev. Date | 2017-06-14 201 |
| Expression Host | Escherichia coli BL21(DE3) |