CoronaVR
PDB Structure details:
| Structure title | The crystal structure of SARS coronavirus ORF-9b protein |
| Source | SARS-related coronavirus |
| Macromolecule name | HYPOTHETICAL PROTEIN 5 |
| Experimental method | X-RAY DIFFRACTION |
| Strucutre Molecular Weight | 68631.35 |
| Residue Count | 615 |
| Sequence | PPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK |
| Chain length | 76 |
| Chain Molecular Weight | 8420.79 |
| Biological process | - |
| Cellular Component | - |
| Molecular Function | - |
| Dep. Date | 5/6/2006 |
| Rel. Date | 2011-05-08 201 |
| Rev. Date | 2011-05-08 201 |
| Expression Host | ESCHERICHIA COLI |